CacheBy
Atlas Antibodies Anti-BBS12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BBS12 Antibody

상품 한눈에 보기

Human BBS12 단백질을 인식하는 토끼 폴리클로날 항체로, Bardet-Biedl syndrome 12 연구용에 적합. PrEST 항원으로 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능. Human에 특이적 반응성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061856-100 Anti-BBS12 Antibody, Bardet-Biedl syndrome 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061856-25 Anti-BBS12 Antibody, Bardet-Biedl syndrome 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BBS12 Antibody

Anti-BBS12 Antibody

Target Information

  • Target Protein: Bardet-Biedl syndrome 12
  • Target Gene: BBS12
  • Alternative Gene Names: C4orf24, FLJ35630, FLJ41559

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal antibody against human BBS12.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Rat ENSRNOG00000007510 78%
Mouse ENSMUSG00000051444 74%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 농도 및 조건은 사용자가 결정해야 합니다.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.