CacheBy
Atlas Antibodies Anti-B4GALT4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B4GALT4 Antibody

상품 한눈에 보기

Human B4GALT4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 재조합 발현 검증 완료. 40% 글리세롤/PBS 버퍼에 보존제로 sodium azide 함유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063546-100 Anti-B4GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063546-25 Anti-B4GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B4GALT4 Antibody

Anti-B4GALT4 Antibody

Target Protein: UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human B4GALT4.

Alternative Gene Names

  • beta4Gal-T4

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:

AIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPF

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000022793 78%
Rat ENSRNOG00000003114 77%

Antibody Characteristics

Parameter Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Base PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
Safety Info Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.