CacheBy
Atlas Antibodies Anti-B4GALT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B4GALT2 Antibody

상품 한눈에 보기

인간 B4GALT2 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, Rat 및 Mouse와 94% 서열 동일성을 가집니다. 면역세포화학 등 다양한 연구용 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047739-100 Anti-B4GALT2 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047739-25 Anti-B4GALT2 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B4GALT2 Antibody

Anti-B4GALT2 Antibody

Target: UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2
Supplier: Atlas Antibodies


면역세포화학 (ICC)


Product Description

Polyclonal Antibody against Human B4GALT2


Alternative Gene Names

  • beta4Gal-T2

Open Datasheet


Target Information

항목 내용
Target Protein UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2
Target Gene B4GALT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019609 (94%), Mouse ENSMUSG00000028541 (94%)

Antigen Sequence

PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.