CacheBy
Atlas Antibodies Anti-B4GALT7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B4GALT7 Antibody

상품 한눈에 보기

Human B4GALT7 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었으며, 40% glycerol/PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042330-100 Anti-B4GALT7 Antibody, xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042330-25 Anti-B4GALT7 Antibody, xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B4GALT7 Antibody

Anti-B4GALT7 Antibody

Target: xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (B4GALT7)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human B4GALT7 protein.

Alternative Gene Names

  • beta4Gal-T7
  • XGALT-1

Open Datasheet

Target Information

항목 내용
Target Protein xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7
Target Gene B4GALT7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:

PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000021886 98%
Mouse ENSMUSG00000021504 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.