CacheBy
Atlas Antibodies Anti-B4GALT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B4GALT1 Antibody

상품 한눈에 보기

인간 B4GALT1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼에서 생산된 IgG 형식입니다. 사람에 대해 검증되었으며, 높은 종간 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010806-100 Anti-B4GALT1 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010806-25 Anti-B4GALT1 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B4GALT1 Antibody

Anti-B4GALT1 Antibody

Target: UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human B4GALT1.

Alternative Gene Names: beta4Gal-T1, GGTB2
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 1
Target Gene B4GALT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028413 (92%)
Rat ENSRNOG00000059461 (91%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.