CacheBy
Atlas Antibodies Anti-B4GALT4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B4GALT4 Antibody

상품 한눈에 보기

인간 B4GALT4 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 재조합 발현 검증 완료, 인간에 대한 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046819-100 Anti-B4GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046819-25 Anti-B4GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B4GALT4 Antibody

Anti-B4GALT4 Antibody

Target: UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Type: Polyclonal Antibody against Human B4GALT4

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody targeting the human B4GALT4 protein.

Alternative Gene Names

  • beta4Gal-T4

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Target Gene B4GALT4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPF
Verified Species Reactivity Human
Interspecies Identity Mouse (78%), Rat (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.