CacheBy
Atlas Antibodies Anti-B4GALNT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B4GALNT2 Antibody

상품 한눈에 보기

Human B4GALNT2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human 반응성이 검증되었으며, 높은 특이성과 안정성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015721-100 Anti-B4GALNT2 Antibody, beta-1,4-N-acetyl-galactosaminyl transferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015721-25 Anti-B4GALNT2 Antibody, beta-1,4-N-acetyl-galactosaminyl transferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B4GALNT2 Antibody

Anti-B4GALNT2 Antibody

beta-1,4-N-acetyl-galactosaminyl transferase 2

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human B4GALNT2.

Alternative Gene Names

Cad, GALGT2, Sda

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein beta-1,4-N-acetyl-galactosaminyl transferase 2
Target Gene B4GALNT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000013418 (79%), Rat ENSRNOG00000010234 (25%)

Antigen Sequence:

LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.