
1 / 2
Atlas Antibodies Anti-B4GALNT1 Antibody
상품 한눈에 보기
Human B4GALNT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. 독립 항체 검증을 통해 신뢰성 확보. Human, Mouse, Rat 반응성 확인. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-B4GALNT1 Antibody
beta-1,4-N-acetyl-galactosaminyl transferase 1
Recommended Applications
- IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Product Description
Polyclonal Antibody against Human B4GALNT1
Alternative Gene Names
beta1-4GalNAc-T, GALGT, SPG26
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | beta-1,4-N-acetyl-galactosaminyl transferase 1 |
| Target Gene | B4GALNT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000006731 (86%), Rat ENSRNOG00000004839 (84%) |
Antigen Sequence:
LAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-B4GALNT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B4GALNT3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B4GALNT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B4GALNT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B3GNTL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.