CacheBy
Atlas Antibodies Anti-ATP6V1C1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP6V1C1 Antibody

상품 한눈에 보기

Human ATP6V1C1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. 고순도의 Affinity purified 제품이며 Human 및 Mouse에 반응합니다. 40% glycerol 기반 buffer에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023943-100 Anti-ATP6V1C1 Antibody, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023943-25 Anti-ATP6V1C1 Antibody, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP6V1C1 Antibody

Anti-ATP6V1C1 Antibody

ATPase, H⁺ transporting, lysosomal 42kDa, V1 subunit C1 단백질을 인식하는 Rabbit Polyclonal 항체입니다.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human ATP6V1C1

Alternative Gene Names

ATP6C, ATP6D, VATC, Vma5

Open Datasheet (PDF)

Target Information

  • Target Protein: ATPase, H⁺ transporting, lysosomal 42kDa, V1 subunit C1
  • Target Gene: ATP6V1C1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000004846 97%
Mouse ENSMUSG00000022295 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.