CacheBy
Atlas Antibodies Anti-ATP6V1C1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP6V1C1 Antibody

상품 한눈에 보기

Human ATP6V1C1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. 고순도의 Affinity 정제 항체이며, 인간과 마우스에 반응합니다. ATPase 복합체의 V1 subunit C1 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057297-100 Anti-ATP6V1C1 Antibody, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057297-25 Anti-ATP6V1C1 Antibody, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP6V1C1 Antibody

Anti-ATP6V1C1 Antibody

ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human ATP6V1C1


Alternative Gene Names

ATP6C, ATP6D, VATC, Vma5

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Target Gene ATP6V1C1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000004846 (97%)
  • Mouse ENSMUSG00000022295 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Base Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.