Atlas Antibodies Anti-ATP6V1B2 Antibody
Human ATP6V1B2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반의 Orthogonal Validation으로 검증됨. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-ATP6V1B2 Antibody
Anti-ATP6V1B2 Antibody
ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human ATP6V1B2.
Alternative Gene Names
ATP6B2, HO57, VATB, Vma2, VPP3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2 |
| Target Gene | ATP6V1B2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE |
Species Reactivity
| Species | Reactivity |
|---|---|
| Human | Verified |
| Mouse | Verified |
| Rat | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000006273 (98%)
- Rat ENSRNOG00000011891 (98%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.