Atlas Antibodies Anti-ATP5F1 Antibody

상품 한눈에 보기

Human ATP5F1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간 시료에 최적화되어 있으며, 단백질 발현 검증 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057347-100 Anti-ATP5F1 Antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057347-25 Anti-ATP5F1 Antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

ATP synthase, H⁺ transporting, mitochondrial Fo complex, subunit B1

Orthogonal validation: Protein expression verified using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Independent validation: Protein expression confirmed in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against Human ATP5F1.

항목	내용
Target Protein	ATP synthase, H⁺ transporting, mitochondrial Fo complex, subunit B1
Target Gene	ATP5F1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKN
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000000563 (81%), Rat ENSRNOG00000046299 (79%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand