
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ATP5D Antibody
상품 한눈에 보기
Human ATP5D 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에서 반응성이 검증되었습니다. 40% glycerol/PBS buffer에 보존되어 안정성이 높습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA002865-100 Anti-ATP5D Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002865-25 Anti-ATP5D Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ATP5D Antibody
Anti-ATP5D Antibody
ATP synthase, H⁺ transporting, mitochondrial F1 complex, delta subunit을 인식하는 Rabbit Polyclonal 항체입니다.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human ATP5D
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP synthase, H⁺ transporting, mitochondrial F1 complex, delta subunit |
| Target Gene | ATP5D |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQ |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| 종 | 유전자 ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000014625 | 92% |
| Mouse | ENSMUSG00000003072 | 90% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도와 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



