Atlas Antibodies Anti-ATP5H Antibody

상품 한눈에 보기

인간 ATP5H 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며 토끼에서 생산되었습니다. 높은 종간 보존성과 신뢰성 있는 단백질 발현 검증을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042777-100 Anti-ATP5H Antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042777-25 Anti-ATP5H Antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

ATP synthase, H⁺ transporting, mitochondrial Fo complex, subunit d

IHC (Immunohistochemistry) – Independent antibody validation by comparing antibodies targeting different epitopes of the same protein.
ICC (Immunocytochemistry)

Polyclonal antibody against human ATP5H.

항목	내용
Target Protein	ATP synthase, H⁺ transporting, mitochondrial Fo complex, subunit d
Target Gene	ATP5H
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse (84%), Rat (80%)

Antigen Sequence:

ALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet