CacheBy
Atlas Antibodies Anti-ATG3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATG3 Antibody

상품 한눈에 보기

Human ATG3 단백질을 인식하는 폴리클로날 항체로, 자가포식 관련 연구에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. IHC 및 RNA-seq 데이터 기반 교차 검증을 통해 단백질 발현이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040471-100 Anti-ATG3 Antibody, autophagy related 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040471-25 Anti-ATG3 Antibody, autophagy related 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATG3 Antibody

Anti-ATG3 Antibody

Target: Autophagy related 3 (ATG3)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human ATG3.


Alternative Gene Names

APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCE

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022663 96%
Rat ENSRNOG00000002094 96%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.