CacheBy
Atlas Antibodies Anti-ATG16L2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATG16L2 Antibody

상품 한눈에 보기

인간 ATG16L2 단백질을 표적으로 하는 폴리클로날 항체로, 자가포식 관련 연구에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, IHC 및 ICC 응용에 권장됩니다. 고순도 Affinity 정제 방식으로 제조되어 신뢰성 높은 결과를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045444-100 Anti-ATG16L2 Antibody, autophagy related 16-like 2 (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045444-25 Anti-ATG16L2 Antibody, autophagy related 16-like 2 (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATG16L2 Antibody

Anti-ATG16L2 Antibody

Target: autophagy related 16-like 2 (S. cerevisiae)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ATG16L2


Alternative Gene Names

ATG16B, FLJ00012, WDR80

Open Datasheet


Target Information

  • Target Protein: autophagy related 16-like 2 (S. cerevisiae)
  • Target Gene: ATG16L2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNS

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Mouse ENSMUSG00000047767 86%
Rat ENSRNOG00000019413 82%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.