AI 생성

1 / 2

Atlas Antibodies Anti-ATG16L1 Antibody

상품 한눈에 보기

ATG16L1 단백질을 인식하는 인간 유래 폴리클로날 항체로 자가포식 관련 연구에 적합. IHC 및 RNA-seq 데이터 기반 정교한 Orthogonal 검증 제공. Rabbit 호스트에서 생산되었으며 Affinity purification으로 높은 특이성 확보.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA063900-100 Anti-ATG16L1 Antibody, autophagy related 16-like 1 (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA063900-25 Anti-ATG16L1 Antibody, autophagy related 16-like 1 (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: autophagy related 16-like 1 (S. cerevisiae)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human ATG16L1

APG16L, ATG16A, ATG16L, FLJ10035, WDR30

항목	내용
Target Protein	autophagy related 16-like 1 (S. cerevisiae)
Target Gene	ATG16L1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000026289 (90%), Rat ENSRNOG00000017913 (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDA

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.