
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ATG16L1 Antibody
상품 한눈에 보기
ATG16L1 단백질을 인식하는 인간 유래 폴리클로날 항체로 자가포식 관련 연구에 적합. IHC 및 RNA-seq 데이터 기반 정교한 Orthogonal 검증 제공. Rabbit 호스트에서 생산되었으며 Affinity purification으로 높은 특이성 확보.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063900-100 Anti-ATG16L1 Antibody, autophagy related 16-like 1 (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063900-25 Anti-ATG16L1 Antibody, autophagy related 16-like 1 (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ATG16L1 Antibody
Anti-ATG16L1 Antibody
Target: autophagy related 16-like 1 (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ATG16L1
Alternative Gene Names
APG16L, ATG16A, ATG16L, FLJ10035, WDR30
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | autophagy related 16-like 1 (S. cerevisiae) |
| Target Gene | ATG16L1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026289 (90%), Rat ENSRNOG00000017913 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDANotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



