
1 / 2
Atlas Antibodies Anti-ATG16L1 Antibody
상품 한눈에 보기
ATG16L1 단백질을 인식하는 인간 유래 폴리클로날 항체로 자가포식 관련 연구에 적합. IHC 및 RNA-seq 데이터 기반 정교한 Orthogonal 검증 제공. Rabbit 호스트에서 생산되었으며 Affinity purification으로 높은 특이성 확보.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATG16L1 Antibody
Target: autophagy related 16-like 1 (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ATG16L1
Alternative Gene Names
APG16L, ATG16A, ATG16L, FLJ10035, WDR30
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | autophagy related 16-like 1 (S. cerevisiae) |
| Target Gene | ATG16L1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026289 (90%), Rat ENSRNOG00000017913 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDANotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATG3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATG16L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATG16L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATG2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATG2B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.