CacheBy
Atlas Antibodies Anti-NOL10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NOL10 Antibody

상품 한눈에 보기

인간 NOL10 단백질에 대한 폴리클로날 항체로 WB 및 ICC 응용에 적합. Rabbit에서 생산된 IgG 형 항체이며 PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, Rat 및 Mouse와 높은 서열 유사성 보유.

카탈로그번호
HPA035286-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035286-100 Anti-NOL10 Antibody, nucleolar protein 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035286-25 Anti-NOL10 Antibody, nucleolar protein 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NOL10 Antibody

Anti-NOL10 Antibody

Target Information

  • Target Protein: Nucleolar protein 10
  • Target Gene: NOL10
  • Alternative Gene Names: FLJ14075, PQBP5

Product Description

Polyclonal antibody against human NOL10.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    QVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000005344 100%
Mouse ENSMUSG00000061458 99%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.