CacheBy
Atlas Antibodies Anti-NOL10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NOL10 Antibody

상품 한눈에 보기

Human NOL10 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간 종에 대해 검증되었으며, 높은 종간 서열 동일성을 가집니다.

카탈로그번호
HPA043075-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043075-100 Anti-NOL10 Antibody, nucleolar protein 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043075-25 Anti-NOL10 Antibody, nucleolar protein 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NOL10 Antibody

Anti-NOL10 Antibody

Target Information

  • Target Protein: Nucleolar protein 10
  • Target Gene: NOL10
  • Alternative Gene Names: FLJ14075, PQBP5

Product Description

Polyclonal antibody against human NOL10.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000005344 (100%)
  • Mouse ENSMUSG00000061458 (99%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications WB, ICC
Verified Species Reactivity Human
Interspecies Identity Rat (100%), Mouse (99%)

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.