CacheBy
Atlas Antibodies Anti-NFKBIE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NFKBIE Antibody

상품 한눈에 보기

인간 NFKBIE 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 연구용에 적합. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화정제됨. 인간에 대해 검증되었으며, Rat 및 Mouse와 87% 서열 유사성을 가짐. 안정한 보관을 위한 글리세롤 기반 완충용액 포함.

카탈로그번호
HPA005941-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005941-100 Anti-NFKBIE Antibody, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005941-25 Anti-NFKBIE Antibody, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NFKBIE Antibody

Anti-NFKBIE Antibody

Full name: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human NFKBIE


Alternative Gene Names

  • IKBE

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Target Gene NFKBIE
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PEPGRGTSHSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKI

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019907 87%
Mouse ENSMUSG00000023947 87%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.