Atlas Antibodies Anti-NCS1 Antibody

상품 한눈에 보기

인간 NCS1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 및 재조합 발현을 통한 정교한 검증 완료. 인간과 마우스에 모두 반응. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019713-100 Anti-NCS1 Antibody, neuronal calcium sensor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019713-25 Anti-NCS1 Antibody, neuronal calcium sensor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Neuronal calcium sensor 1 (NCS1)
Supplier: Atlas Antibodies

IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
WB (Recombinant Expression Validation): Confirmed using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human NCS1.

FREQ, NCS-1

항목	내용
Target Protein	Neuronal calcium sensor 1
Target Gene	NCS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Verified Species Reactivity	Human, Mouse
Interspecies Identity	Rat ENSRNOG00000008761 (100%), Mouse ENSMUSG00000062661 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand