CacheBy
Atlas Antibodies Anti-NCSTN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCSTN Antibody

상품 한눈에 보기

인간 NCSTN 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었고, 높은 종간 반응 특이성을 보입니다. 안정적인 PBS/glycerol 버퍼로 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054846-100 Anti-NCSTN Antibody, nicastrin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054846-25 Anti-NCSTN Antibody, nicastrin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCSTN Antibody

Anti-NCSTN Antibody

Target Information

  • Target Protein: Nicastrin
  • Target Gene: NCSTN
  • Alternative Gene Names: APH2, KIAA0253

Product Description

Polyclonal antibody against human NCSTN.

면역조직화학(IHC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    VQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000003458): 91%
  • Rat (ENSRNOG00000005355): 90%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.