원본
Atlas Antibodies Anti-NCR1 Antibody
상품 한눈에 보기
Human NCR1(CD335/NKp46) 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. 면역세포 표지 및 연구용으로 적합하며, Human에 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049311-100 Anti-NCR1 Antibody, natural cytotoxicity triggering receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049311-25 Anti-NCR1 Antibody, natural cytotoxicity triggering receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NCR1 Antibody
Anti-NCR1 Antibody
Target: natural cytotoxicity triggering receptor 1 (NCR1)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human NCR1.
Alternative Gene Names
CD335, LY94, NK-p46, NKP46
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | natural cytotoxicity triggering receptor 1 |
| Target Gene | NCR1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000018458 | 61% |
| Mouse | ENSMUSG00000062524 | 59% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.