CacheBy
Atlas Antibodies Anti-NCR1 Antibody
원본

Atlas Antibodies Anti-NCR1 Antibody

상품 한눈에 보기

Human NCR1(CD335/NKp46) 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. 면역세포 표지 및 연구용으로 적합하며, Human에 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049311-100 Anti-NCR1 Antibody, natural cytotoxicity triggering receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049311-25 Anti-NCR1 Antibody, natural cytotoxicity triggering receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCR1 Antibody

Anti-NCR1 Antibody

Target: natural cytotoxicity triggering receptor 1 (NCR1)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NCR1.

Alternative Gene Names

CD335, LY94, NK-p46, NKP46

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein natural cytotoxicity triggering receptor 1
Target Gene NCR1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Antigen Sequence Identity
Rat ENSRNOG00000018458 61%
Mouse ENSMUSG00000062524 59%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.