Atlas Antibodies Anti-NCOA4 Antibody

상품 한눈에 보기

인간 NCOA4 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합. 고순도 및 높은 종 특이성 확보.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051260-100 Anti-NCOA4 Antibody, nuclear receptor coactivator 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051260-25 Anti-NCOA4 Antibody, nuclear receptor coactivator 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Nuclear receptor coactivator 4 (NCOA4)
Supplier: Atlas Antibodies

Polyclonal antibody against human NCOA4, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

ARA70, DKFZp762E1112, ELE1, PTC3, RFG

Target Protein: Nuclear receptor coactivator 4
Target Gene: NCOA4
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Applications	ICC (Immunocytochemistry) and other recommended assays