CacheBy
Atlas Antibodies Anti-NCOA4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCOA4 Antibody

상품 한눈에 보기

인간 NCOA4 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합. 고순도 및 높은 종 특이성 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051260-100 Anti-NCOA4 Antibody, nuclear receptor coactivator 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051260-25 Anti-NCOA4 Antibody, nuclear receptor coactivator 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCOA4 Antibody

Anti-NCOA4 Antibody

Target: Nuclear receptor coactivator 4 (NCOA4)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human NCOA4, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

ARA70, DKFZp762E1112, ELE1, PTC3, RFG


Target Information

  • Target Protein: Nuclear receptor coactivator 4
  • Target Gene: NCOA4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000019768 (86%)
  • Mouse ENSMUSG00000021908 (86%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications ICC (Immunocytochemistry) and other recommended assays

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.