
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NCOA4 Antibody
상품 한눈에 보기
Human NCOA4 단백질을 인식하는 토끼 폴리클로날 항체로, 핵 수용체 코액티베이터 4 검출에 적합. ICC 등 다양한 응용에 권장되며, 고순도 Affinity 정제 방식으로 제조됨. 인체 반응성 검증 완료, 안정적 PBS/glycerol buffer 포맷 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065208-100 Anti-NCOA4 Antibody, nuclear receptor coactivator 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065208-25 Anti-NCOA4 Antibody, nuclear receptor coactivator 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NCOA4 Antibody
Anti-NCOA4 Antibody
Target: Nuclear receptor coactivator 4 (NCOA4)
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal Antibody against Human NCOA4
Alternative Gene Names
ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Nuclear receptor coactivator 4 |
| Target Gene | NCOA4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000019768 (86%), Mouse ENSMUSG00000021908 (86%) |
Antigen Sequence:
KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



