
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NCCRP1 Antibody
상품 한눈에 보기
인간 NCCRP1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원 기반으로 특이적 정제되었으며, 글리세롤 및 PBS 버퍼에 보존됩니다. 인간 반응성이 검증되어 신뢰성 높은 연구용 시약입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052812-100 Anti-NCCRP1 Antibody, non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052812-25 Anti-NCCRP1 Antibody, non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NCCRP1 Antibody
Anti-NCCRP1 Antibody
Target: non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human NCCRP1
Alternative Gene Names
FBXO50, LOC342897, NCCRP-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) |
| Target Gene | NCCRP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000054506 (78%), Mouse ENSMUSG00000047586 (77%) |
Antigen Sequence:
RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



