CacheBy
Atlas Antibodies Anti-NCCRP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCCRP1 Antibody

상품 한눈에 보기

인간 NCCRP1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원 기반으로 특이적 정제되었으며, 글리세롤 및 PBS 버퍼에 보존됩니다. 인간 반응성이 검증되어 신뢰성 높은 연구용 시약입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052812-100 Anti-NCCRP1 Antibody, non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052812-25 Anti-NCCRP1 Antibody, non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCCRP1 Antibody

Anti-NCCRP1 Antibody

Target: non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NCCRP1

Alternative Gene Names

FBXO50, LOC342897, NCCRP-1

Open Datasheet

Target Information

항목 내용
Target Protein non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
Target Gene NCCRP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000054506 (78%), Mouse ENSMUSG00000047586 (77%)

Antigen Sequence:
RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.