AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NCAPG2 Antibody
상품 한눈에 보기
Human NCAPG2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 용액에 보존됩니다. 인간에 반응하며 설치류와 유사성이 높습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026631-100 Anti-NCAPG2 Antibody, non-SMC condensin II complex, subunit G2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026631-25 Anti-NCAPG2 Antibody, non-SMC condensin II complex, subunit G2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NCAPG2 Antibody
Anti-NCAPG2 Antibody
Target: non-SMC condensin II complex, subunit G2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human NCAPG2.
Alternative Gene Names
CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | non-SMC condensin II complex, subunit G2 |
| Target Gene | NCAPG2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Identity | Rat ENSRNOG00000004968 (70%), Mouse ENSMUSG00000042029 (69%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Material Safety Data Sheet | MSDS - Sodium Azide |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.