CacheBy
Atlas Antibodies Anti-NCBP2L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCBP2L Antibody

상품 한눈에 보기

인간 NCBP2L 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit에서 생산된 IgG 형식으로, PrEST 항원으로 친화 정제되었습니다. IHC 등 다양한 응용에 적합하며, PBS와 글리세롤 기반 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010664-100 Anti-NCBP2L Antibody, nuclear cap binding protein subunit 2-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010664-25 Anti-NCBP2L Antibody, nuclear cap binding protein subunit 2-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCBP2L Antibody

Anti-NCBP2L Antibody

Target Information

  • Target Protein: Nuclear cap binding protein subunit 2-like
  • Target Gene: NCBP2L
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
RDHQFSGRKFQQEKLLKESSTLNMGNLSFYTTEEKIHELFSRSDIRNIFMGLDKIKKTACGFCFVECHNRADAENAMRFLTGTCLDEWIICTDWDVGFREGQQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000048589 (69%)
  • Mouse ENSMUSG00000022774 (69%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet: MSDS - Sodium Azide

Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Recommended Application - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.