Atlas Antibodies Anti-NBPF6 Antibody

상품 한눈에 보기

Human NBPF6 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 적합하며, Human 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047447-100 Anti-NBPF6 Antibody, neuroblastoma breakpoint family, member 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047447-25 Anti-NBPF6 Antibody, neuroblastoma breakpoint family, member 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Neuroblastoma breakpoint family, member 6 (NBPF6)
Supplier: Atlas Antibodies

Polyclonal antibody against human NBPF6.
Affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	Neuroblastoma breakpoint family, member 6
Target Gene	NBPF6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000012728 (30%), Mouse ENSMUSG00000039703 (27%)

Antigen Sequence:

KQSDLEEVKGQETVAPRLSRGPLRVDKHEIPQESLDGCCLTPSILPDLTPSYHPYWSTLYSFEDKQVSLALVDK

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet