
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTUS2 Antibody
상품 한눈에 보기
Human MTUS2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 대한 반응성이 검증됨.
- 카탈로그번호
- HPA031474-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031474-100 Anti-MTUS2 Antibody, microtubule associated tumor suppressor candidate 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031474-25 Anti-MTUS2 Antibody, microtubule associated tumor suppressor candidate 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTUS2 Antibody
Anti-MTUS2 Antibody
Target: microtubule associated tumor suppressor candidate 2 (MTUS2)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human MTUS2
Alternative Gene Names
CAZIP, ICIS, KIAA0774, TIP150
Target Information
- Target Protein: microtubule associated tumor suppressor candidate 2
- Target Gene: MTUS2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KEIPSKLEAQLGQGKGEAKLDLKYVPPRRVEQEGKAAQEGYLGCHKEENLSALEGRDPCGEAHPEATDALGHLLNSDLHHLGVGRGNCEEKRGVNPGEQ
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000029651) – 37%
- Rat (ENSRNOG00000032410) – 36%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



