CacheBy
Atlas Antibodies Anti-MTUS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTUS1 Antibody

상품 한눈에 보기

Human MTUS1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 재현성을 제공. Human 종에 반응하며, 연구용으로 microtubule 관련 종양 억제 단백질 분석에 적합.

카탈로그번호
HPA069795-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069795-100 Anti-MTUS1 Antibody, microtubule associated tumor suppressor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069795-25 Anti-MTUS1 Antibody, microtubule associated tumor suppressor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTUS1 Antibody

Anti-MTUS1 Antibody

Target: Microtubule Associated Tumor Suppressor 1 (MTUS1)
Supplier: Atlas Antibodies


ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against human MTUS1.


Alternative Gene Names

ATBP, ATIP1, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1

Open Datasheet


Target Information

  • Target Protein: Microtubule associated tumor suppressor 1
  • Target Gene: MTUS1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000010748 56%
Mouse ENSMUSG00000045636 56%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.