
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTUS2 Antibody
상품 한눈에 보기
Human MTUS2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식의 항체입니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 연구 응용에 적합합니다. Glycerol/PBS buffer에 보존되어 안정성이 우수합니다.
- 카탈로그번호
- HPA031473-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031473-100 Anti-MTUS2 Antibody, microtubule associated tumor suppressor candidate 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031473-25 Anti-MTUS2 Antibody, microtubule associated tumor suppressor candidate 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTUS2 Antibody
Anti-MTUS2 Antibody
microtubule associated tumor suppressor candidate 2
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human MTUS2.
Alternative Gene Names
CAZIP, ICIS, KIAA0774, TIP150
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule associated tumor suppressor candidate 2 |
| Target Gene | MTUS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KEIPSKLEAQLGQGKGEAKLDLKYVPPRRVEQEGKAAQEGYLGCHKEENLSALEGRDPCGEAHPEATDALGHLLNSDLHHLGVGRGNCEEKRGVNPGEQ |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000029651 (37%)
- Rat ENSRNOG00000032410 (36%)
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



