CacheBy
Atlas Antibodies Anti-MT-CO2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-MT-CO2 Antibody

상품 한눈에 보기

인간 MT-CO2 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB에서 독립적 항체 검증을 통해 단백질 발현 확인에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공.

카탈로그번호
HPA051505-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051505-100 Anti-MT-CO2 Antibody, mitochondrially encoded cytochrome c oxidase II 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051505-25 Anti-MT-CO2 Antibody, mitochondrially encoded cytochrome c oxidase II 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MT-CO2 Antibody

Anti-MT-CO2 Antibody

Target: Mitochondrially encoded cytochrome c oxidase II
Supplier: Atlas Antibodies

  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human MT-CO2

Alternative Gene Names

CO2, COX2, MTCO2

Target Information

항목 내용
Target Protein Mitochondrially encoded cytochrome c oxidase II
Target Gene MT-CO2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000064354 (71%), Rat ENSRNOG00000030371 (71%)

Antigen Sequence: 

TDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEIGPVFT

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Enhanced Validation
IHC Validation
WB Validation

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-MT-CO2 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MT-CO1 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MST1R Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MST1R Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.