CacheBy
Atlas Antibodies Anti-MSRB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MSRB2 Antibody

상품 한눈에 보기

인간 MSRB2 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 검증 완료. 재조합 발현 및 RNA-seq 기반 직교 검증 수행. 토끼 유래 IgG 항체이며, 친화 정제 방식으로 생산. PBS/glycerol 완충액에 보존제로 sodium azide 포함.

카탈로그번호
HPA027933-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027933-100 Anti-MSRB2 Antibody, methionine sulfoxide reductase B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027933-25 Anti-MSRB2 Antibody, methionine sulfoxide reductase B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MSRB2 Antibody

Anti-MSRB2 Antibody

Target: methionine sulfoxide reductase B2 (MSRB2)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
  • WB (Recombinant expression validation): Validation performed using target protein overexpression.

Product Description

Polyclonal antibody against human MSRB2.


Alternative Gene Names

CBS-1, CBS1, CGI-131, MSRB, PILB

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein methionine sulfoxide reductase B2
Target Gene MSRB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSV
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000016873 (87%), Mouse ENSMUSG00000023094 (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Info Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
IHC Orthogonal Tooltip
WB Validation
WB Recombinant Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.