Atlas Antibodies Anti-MSRA Antibody

상품 한눈에 보기

Human MSRA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.

카탈로그번호: HPA053069-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053069-100 Anti-MSRA Antibody, methionine sulfoxide reductase A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053069-25 Anti-MSRA Antibody, methionine sulfoxide reductase A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MSRA Antibody

Anti-MSRA Antibody

Target Information

Target Protein: Methionine sulfoxide reductase A
Target Gene: MSRA
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000054733 (85%)
Rat ENSRNOG00000012440 (84%)

Product Description

Polyclonal antibody against human MSRA.
Recommended for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).
Open Datasheet

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	IHC, WB, ICC