
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MSRB1 Antibody
상품 한눈에 보기
Human MSRB1 단백질을 인식하는 고품질 폴리클론 항체로, Rabbit에서 생산된 IgG 형태입니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, ICC 등 다양한 연구 응용에 적합합니다.
- 카탈로그번호
- HPA069557-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA069557-100 Anti-MSRB1 Antibody, methionine sulfoxide reductase B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069557-25 Anti-MSRB1 Antibody, methionine sulfoxide reductase B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MSRB1 Antibody
Anti-MSRB1 Antibody
Target Protein: Methionine sulfoxide reductase B1 (MSRB1)
Recommended Applications
- Immunocytochemistry (ICC)
- 기타 연구용 응용
Product Description
Polyclonal Antibody against Human MSRB1
Alternative Gene Names
- SelR
- SelX
- SepR
- SEPX1
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000040209 | 27% |
| Rat | ENSRNOG00000017419 | 24% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



