CacheBy
Atlas Antibodies Anti-MSI2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MSI2 Antibody

상품 한눈에 보기

Human MSI2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대해 검증되었으며, Mouse 및 Rat과 100% 서열 동일성을 가집니다.

카탈로그번호
HPA068990-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068990-100 Anti-MSI2 Antibody, musashi RNA binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068990-25 Anti-MSI2 Antibody, musashi RNA binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MSI2 Antibody

Anti-MSI2 Antibody

Target Information

  • Target Protein: Musashi RNA binding protein 2
  • Target Gene: MSI2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    NFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAA
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human MSI2.
Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse: ENSMUSG00000069769 (100%)
  • Rat: ENSRNOG00000025338 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
  • Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.