CacheBy
Atlas Antibodies Anti-MSL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MSL1 Antibody

상품 한눈에 보기

Human MSL1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간과 높은 종간 보존성을 보여 연구용으로 신뢰성이 높음.

카탈로그번호
HPA023567-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023567-100 Anti-MSL1 Antibody, male-specific lethal 1 homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023567-25 Anti-MSL1 Antibody, male-specific lethal 1 homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MSL1 Antibody

Anti-MSL1 Antibody

Target: male-specific lethal 1 homolog (Drosophila)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MSL1.

Alternative Gene Names

DKFZp686P24239, hMSL1, MSL-1

Open Datasheet

Target Information

항목 내용
Target Protein male-specific lethal 1 homolog (Drosophila)
Target Gene MSL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000009643 (94%)
  • Mouse ENSMUSG00000052915 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.