CacheBy
Atlas Antibodies Anti-MSL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MSL2 Antibody

상품 한눈에 보기

Human MSL2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 보존성을 가지며, 최적 농도는 사용자가 실험 조건에 맞게 조정 가능합니다.

카탈로그번호
HPA048482-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048482-100 Anti-MSL2 Antibody, male-specific lethal 2 homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048482-25 Anti-MSL2 Antibody, male-specific lethal 2 homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MSL2 Antibody

Anti-MSL2 Antibody

Target Information

  • Target Protein: male-specific lethal 2 homolog (Drosophila)
  • Target Gene: MSL2
  • Alternative Gene Names: FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184

Product Description

Polyclonal antibody against Human MSL2.

  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000066415 98%
Rat ENSRNOG00000023021 98%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.