원본

Atlas Antibodies Anti-MSH5 Antibody

상품 한눈에 보기

Human MSH5 단백질을 인식하는 토끼 유래 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 기반 PBS 버퍼에 보존제로 소듐 아지드 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062688-100 Anti-MSH5 Antibody, mutS homolog 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062688-25 Anti-MSH5 Antibody, mutS homolog 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: mutS homolog 5
Target Gene: MSH5
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK
```

Highest antigen sequence identity to the following orthologs:

Polyclonal antibody against human MSH5.

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand