CacheBy
Atlas Antibodies Anti-MRPS16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS16 Antibody

상품 한눈에 보기

인간 MRPS16 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 마우스, 랫트와 높은 서열 유사성 보유.

카탈로그번호
HPA054538-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054538-100 Anti-MRPS16 Antibody, mitochondrial ribosomal protein S16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054538-25 Anti-MRPS16 Antibody, mitochondrial ribosomal protein S16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS16 Antibody

Anti-MRPS16 Antibody

Target: mitochondrial ribosomal protein S16

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human MRPS16.

Alternative Gene Names

  • CGI-132

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mitochondrial ribosomal protein S16
Target Gene MRPS16
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDT
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000049960 (89%), Rat ENSRNOG00000006898 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.