Atlas Antibodies Anti-MRPS16 Antibody

상품 한눈에 보기

인간 MRPS16 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit IgG 기반이며 PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050081-100 Anti-MRPS16 Antibody, mitochondrial ribosomal protein S16 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050081-25 Anti-MRPS16 Antibody, mitochondrial ribosomal protein S16 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Mitochondrial ribosomal protein S16
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Western Blot (WB) – Independent validation by comparing antibodies targeting different epitopes
Immunocytochemistry (ICC)

Polyclonal antibody against human MRPS16.

항목	내용
Target Protein	Mitochondrial ribosomal protein S16
Target Gene	MRPS16
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDT
Verified Species Reactivity	Human
Interspecies Identity	Mouse (89%), Rat (88%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.