
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS12 Antibody
상품 한눈에 보기
Human MRPS12 단백질을 인식하는 토끼 폴리클로날 항체로, 미토콘드리아 리보솜 단백질 S12 검출에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 친화 정제됨. PBS/glycerol buffer로 안정화되어 장기 보관에 용이.
- 카탈로그번호
- HPA050633-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050633-100 Anti-MRPS12 Antibody, mitochondrial ribosomal protein S12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050633-25 Anti-MRPS12 Antibody, mitochondrial ribosomal protein S12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS12 Antibody
Anti-MRPS12 Antibody
Target Information
- Target Protein: Mitochondrial ribosomal protein S12
- Target Gene: MRPS12
- Alternative Gene Names: RPMS12, RPS12, RPSM12
Recommended Applications
IHC (Immunohistochemistry)
Product Description
Polyclonal antibody against human MRPS12.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000019949): 79%
- Mouse (ENSMUSG00000045948): 74%
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



