CacheBy
Atlas Antibodies Anti-ARMC7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARMC7 Antibody

상품 한눈에 보기

Human ARMC7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며 Human, Mouse, Rat에 반응합니다. 40% glycerol/PBS buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024229-100 Anti-ARMC7 Antibody, armadillo repeat containing 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024229-25 Anti-ARMC7 Antibody, armadillo repeat containing 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARMC7 Antibody

Anti-ARMC7 Antibody

Target Protein: armadillo repeat containing 7 (ARMC7)
Product Type: Polyclonal Antibody against Human ARMC7


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Rabbit polyclonal antibody raised against human ARMC7 protein.
Validated for use in IHC, WB, and ICC applications.


Alternative Gene Names

  • FLJ22160

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein armadillo repeat containing 7
Target Gene ARMC7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Amino Acid Sequence MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGG
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000042691 (92%), Mouse ENSMUSG00000057219 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.