
1 / 2
Atlas Antibodies Anti-ARMC7 Antibody
상품 한눈에 보기
사람 ARMC7 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 사람, 마우스, 랫트 반응성 검증. 글리세롤 및 PBS 완충액에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARMC7 Antibody
Target Protein: armadillo repeat containing 7 (ARMC7)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ARMC7.
Alternative Gene Names
- FLJ22160
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | armadillo repeat containing 7 |
| Target Gene | ARMC7 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGG |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000042691 (92%)
- Mouse ENSMUSG00000057219 (90%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARMC7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARMC9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARMC7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARMCX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARMCX2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.