CacheBy
Atlas Antibodies Anti-ARMC8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARMC8 Antibody

상품 한눈에 보기

Human ARMC8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 추천됩니다. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤/PBS 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036996-100 Anti-ARMC8 Antibody, armadillo repeat containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036996-25 Anti-ARMC8 Antibody, armadillo repeat containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARMC8 Antibody

Anti-ARMC8 Antibody

Target: armadillo repeat containing 8 (ARMC8)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ARMC8 protein.


Alternative Gene Names

DKFZP434A043, GID5, HSPC056, VID28

Open Datasheet


Target Information

항목 내용
Target Protein armadillo repeat containing 8
Target Gene ARMC8
Antigen Sequence AVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000032468 (99%), Rat ENSRNOG00000014521 (99%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.