CacheBy
Atlas Antibodies Anti-ARMCX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARMCX1 Antibody

상품 한눈에 보기

Human ARMCX1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형태입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 특이적으로 반응하며, 안정적 PBS/glycerol buffer로 제공됩니다.

카탈로그번호
HPA005685-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005685-100 Anti-ARMCX1 Antibody, armadillo repeat containing, X-linked 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005685-25 Anti-ARMCX1 Antibody, armadillo repeat containing, X-linked 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARMCX1 Antibody

Anti-ARMCX1 Antibody

Target: armadillo repeat containing, X-linked 1 (ARMCX1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ARMCX1.


Alternative Gene Names

  • ALEX1
  • GASP7

Open Datasheet


Target Information

항목 내용
Target Protein armadillo repeat containing, X-linked 1
Target Gene ARMCX1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000033460 (57%), Rat ENSRNOG00000046862 (57%)

Antigen Sequence:
DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.