Atlas Antibodies Anti-AP3B2 Antibody

상품 한눈에 보기

인간 AP3B2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 단백질 발현 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039467-100 Anti-AP3B2 Antibody, adaptor-related protein complex 3, beta 2 subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039467-25 Anti-AP3B2 Antibody, adaptor-related protein complex 3, beta 2 subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: adaptor-related protein complex 3, beta 2 subunit (AP3B2)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Orthogonal validation of protein expression by comparison to RNA-seq data in high and low expression tissues.
WB (Western Blot): Recombinant expression validation using target protein overexpression.

Polyclonal antibody against human AP3B2.

항목	내용
Target Protein	adaptor-related protein complex 3, beta 2 subunit
Target Gene	AP3B2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000062444 (95%), Rat ENSRNOG00000019249 (93%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand