
1 / 2
Atlas Antibodies Anti-AP3B1 Antibody
상품 한눈에 보기
인간 AP3B1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성 검증 완료, 높은 종간 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AP3B1 Antibody
Target: adaptor-related protein complex 3, beta 1 subunit
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human AP3B1.
Alternative Gene Names
ADTB3A, HPS2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adaptor-related protein complex 3, beta 1 subunit |
| Target Gene | AP3B1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000021686 (82%), Rat ENSRNOG00000010624 (80%) |
Antigen Sequence:
VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-AP2M1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AP3B2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AP3B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AP2A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AP2B1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.