CacheBy
Atlas Antibodies Anti-AP2M1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AP2M1 Antibody

상품 한눈에 보기

인간 AP2M1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제됨. 인간, 생쥐, 랫트에서 100% 반응성이 검증됨. 안정한 PBS/glycerol 버퍼에 보존됨.

카탈로그번호
HPA036849-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036849-100 Anti-AP2M1 Antibody, adaptor-related protein complex 2, mu 1 subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036849-25 Anti-AP2M1 Antibody, adaptor-related protein complex 2, mu 1 subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AP2M1 Antibody

Anti-AP2M1 Antibody

Target: adaptor-related protein complex 2, mu 1 subunit
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human AP2M1.

Alternative Gene Names

  • AP50
  • CLAPM1
  • mu2

Open Datasheet (PDF)

Target Information

  • Target Protein: adaptor-related protein complex 2, mu 1 subunit
  • Target Gene: AP2M1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000022841 (100%)
  • Rat ENSRNOG00000001709 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.